General Information

  • ID:  hor005626
  • Uniprot ID:  Q8MP00
  • Protein name:  Neuropeptide F
  • Gene name:  npf
  • Organism:  Aedes aegypti (Yellowfever mosquito) (Culex aegypti)
  • Family:  NPY family
  • Source:  animal
  • Expression:  Expressed in hemolymph, brain and midgut.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Stegomyia (subgenus), Aedes (genus), Aedini (tribe), Culicinae (subfamily), Culicidae (family), Culicoidea (superfamily), Culicomorpha (infraorder), Nematocera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007586 digestion
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SFTDARPQDDPTSVAEAIRLLQELETKHAQHARPRF
  • Length:  36
  • Propeptide:  MTFSTSSSFSRRALVALLVCTLLIDLSSFTDARPQDDPTSVAEAIRLLQELETKHAQHARPRFGKRSYLNPAGYGQDEQEDDWQDSTFTR
  • Signal peptide:  MTFSTSSSFSRRALVALLVCTLLIDLS
  • Modification:  T36 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  An integral part of the sensory system that mediates food signaling, providing the neural basis for the regulation of food response; coordinates larval foraging and social behavior changes during development. May have a hormonal role in females.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q90Y63-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005626_AF2.pdbhor005626_ESM.pdb

Physical Information

Mass: 475704 Formula: C179H284N56O57
Absent amino acids: CGMNWY Common amino acids: A
pI: 6.51 Basic residues: 7
Polar residues: 5 Hydrophobic residues: 12
Hydrophobicity: -93.33 Boman Index: -11354
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 65.28
Instability Index: 4343.33 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  12182937
  • Title:  Neuropeptide F and its expression in the yellow fever mosquito, Aedes aegypti.
  • PubMed ID:  12364794
  • Title:  Neuropeptides and peptide hormones in Anopheles gambiae.